Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 80699..80952 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107418 | ||
| Organism | Klebsiella pneumoniae strain CRKP_21 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH498_RS27515 | Protein ID | WP_001312851.1 |
| Coordinates | 80803..80952 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 80699..80758 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH498_RS27475 (76359) | 76359..76424 | - | 66 | Protein_104 | helix-turn-helix domain-containing protein | - |
| OH498_RS27480 (76477) | 76477..77181 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH498_RS27485 (77206) | 77206..77406 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OH498_RS27490 (77426) | 77426..78172 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH498_RS27495 (78227) | 78227..78787 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH498_RS27500 (78919) | 78919..79119 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OH498_RS27505 (79505) | 79505..80104 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH498_RS27510 (80166) | 80166..80498 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (80699) | 80699..80758 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (80699) | 80699..80758 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (80699) | 80699..80758 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (80699) | 80699..80758 | - | 60 | NuclAT_1 | - | Antitoxin |
| OH498_RS27515 (80803) | 80803..80952 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OH498_RS27520 (81236) | 81236..81484 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH498_RS27525 (81729) | 81729..81803 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH498_RS27530 (81796) | 81796..82653 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH498_RS27535 (83592) | 83592..84245 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH498_RS27540 (84338) | 84338..84595 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH498_RS27545 (84528) | 84528..84929 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH498_RS27550 (85178) | 85178..85593 | + | 416 | Protein_119 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..210034 | 210034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261194 WP_001312851.1 NZ_CP107418:80803-80952 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261194 NZ_CP107418:c80758-80699 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
