Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73537..73790 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107414 | ||
| Organism | Klebsiella pneumoniae strain CRKP_22 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH525_RS28250 | Protein ID | WP_001312851.1 |
| Coordinates | 73641..73790 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 73537..73596 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH525_RS28210 (69197) | 69197..69262 | - | 66 | Protein_85 | helix-turn-helix domain-containing protein | - |
| OH525_RS28215 (69315) | 69315..70019 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH525_RS28220 (70044) | 70044..70244 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OH525_RS28225 (70264) | 70264..71010 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH525_RS28230 (71065) | 71065..71625 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH525_RS28235 (71757) | 71757..71957 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OH525_RS28240 (72343) | 72343..72942 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH525_RS28245 (73004) | 73004..73336 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (73537) | 73537..73596 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (73537) | 73537..73596 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (73537) | 73537..73596 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (73537) | 73537..73596 | - | 60 | NuclAT_1 | - | Antitoxin |
| OH525_RS28250 (73641) | 73641..73790 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OH525_RS28255 (74074) | 74074..74322 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH525_RS28260 (74567) | 74567..74641 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH525_RS28265 (74634) | 74634..75491 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH525_RS28270 (76430) | 76430..77083 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH525_RS28275 (77176) | 77176..77433 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH525_RS28280 (77366) | 77366..77767 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH525_RS28285 (78016) | 78016..78431 | + | 416 | Protein_100 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..146158 | 146158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261172 WP_001312851.1 NZ_CP107414:73641-73790 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261172 NZ_CP107414:c73596-73537 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
