Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79914..80167 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107409 | ||
| Organism | Klebsiella pneumoniae strain CRKP_24 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH533_RS27965 | Protein ID | WP_001312851.1 |
| Coordinates | 79914..80063 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 80108..80167 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH533_RS27930 (75273) | 75273..75688 | - | 416 | Protein_91 | IS1-like element IS1B family transposase | - |
| OH533_RS27935 (75937) | 75937..76338 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH533_RS27940 (76271) | 76271..76528 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH533_RS27945 (76621) | 76621..77274 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH533_RS27950 (78213) | 78213..79070 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH533_RS27955 (79063) | 79063..79137 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH533_RS27960 (79382) | 79382..79630 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH533_RS27965 (79914) | 79914..80063 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (80108) | 80108..80167 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (80108) | 80108..80167 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (80108) | 80108..80167 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (80108) | 80108..80167 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH533_RS27970 (80368) | 80368..80700 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH533_RS27975 (80762) | 80762..81361 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH533_RS27980 (81747) | 81747..81947 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH533_RS27985 (82079) | 82079..82639 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH533_RS27990 (82694) | 82694..83440 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH533_RS27995 (83460) | 83460..83660 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH533_RS28000 (83685) | 83685..84389 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH533_RS28005 (84442) | 84442..84507 | + | 66 | Protein_106 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / catA2 | - | 1..157273 | 157273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261149 WP_001312851.1 NZ_CP107409:c80063-79914 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261149 NZ_CP107409:80108-80167 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
