Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 52412..52838 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107409 | ||
Organism | Klebsiella pneumoniae strain CRKP_24 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OH533_RS27775 | Protein ID | WP_001372321.1 |
Coordinates | 52412..52537 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 52614..52838 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH533_RS27740 (47467) | 47467..47694 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
OH533_RS27745 (47788) | 47788..48474 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OH533_RS27750 (48665) | 48665..49048 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OH533_RS27755 (49325) | 49325..49972 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OH533_RS27760 (50269) | 50269..51090 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OH533_RS27765 (51201) | 51201..51497 | - | 297 | WP_001272251.1 | hypothetical protein | - |
OH533_RS27770 (51797) | 51797..52093 | + | 297 | Protein_59 | hypothetical protein | - |
OH533_RS27775 (52412) | 52412..52537 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OH533_RS27780 (52479) | 52479..52628 | - | 150 | Protein_61 | plasmid maintenance protein Mok | - |
- (52614) | 52614..52838 | - | 225 | NuclAT_0 | - | Antitoxin |
- (52614) | 52614..52838 | - | 225 | NuclAT_0 | - | Antitoxin |
- (52614) | 52614..52838 | - | 225 | NuclAT_0 | - | Antitoxin |
- (52614) | 52614..52838 | - | 225 | NuclAT_0 | - | Antitoxin |
OH533_RS27785 (52850) | 52850..53569 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
OH533_RS27790 (53566) | 53566..54000 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OH533_RS27795 (54069) | 54069..56092 | - | 2024 | Protein_64 | ParB/RepB/Spo0J family partition protein | - |
OH533_RS27800 (56153) | 56153..56386 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
OH533_RS27805 (56444) | 56444..56971 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OH533_RS27810 (57273) | 57273..57734 | + | 462 | Protein_67 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / catA2 | - | 1..157273 | 157273 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261146 WP_001372321.1 NZ_CP107409:c52537-52412 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261146 NZ_CP107409:c52838-52614 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|