Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78243..78496 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107404 | ||
| Organism | Klebsiella pneumoniae strain CRKP_25 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH516_RS27445 | Protein ID | WP_001312851.1 |
| Coordinates | 78243..78392 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78437..78496 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH516_RS27410 (73602) | 73602..74017 | - | 416 | Protein_90 | IS1-like element IS1B family transposase | - |
| OH516_RS27415 (74266) | 74266..74667 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH516_RS27420 (74600) | 74600..74857 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH516_RS27425 (74950) | 74950..75603 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH516_RS27430 (76542) | 76542..77399 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH516_RS27435 (77392) | 77392..77466 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH516_RS27440 (77711) | 77711..77959 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH516_RS27445 (78243) | 78243..78392 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (78437) | 78437..78496 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78437) | 78437..78496 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78437) | 78437..78496 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78437) | 78437..78496 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH516_RS27450 (78697) | 78697..79029 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH516_RS27455 (79091) | 79091..79690 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH516_RS27460 (80076) | 80076..80276 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH516_RS27465 (80408) | 80408..80968 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH516_RS27470 (81023) | 81023..81769 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH516_RS27475 (81789) | 81789..81989 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH516_RS27480 (82014) | 82014..82718 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH516_RS27485 (82771) | 82771..82836 | + | 66 | Protein_105 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154719 | 154719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261126 WP_001312851.1 NZ_CP107404:c78392-78243 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261126 NZ_CP107404:78437-78496 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|