Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 115262..115531 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107400 | ||
Organism | Klebsiella pneumoniae strain CRKP_26 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OH520_RS28310 | Protein ID | WP_001372321.1 |
Coordinates | 115406..115531 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 115262..115327 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH520_RS28280 | 110972..111499 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OH520_RS28285 | 111557..111790 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
OH520_RS28290 | 111851..113874 | + | 2024 | Protein_145 | ParB/RepB/Spo0J family partition protein | - |
OH520_RS28295 | 113943..114377 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OH520_RS28300 | 114374..115093 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 115105..115329 | + | 225 | NuclAT_0 | - | - |
- | 115105..115329 | + | 225 | NuclAT_0 | - | - |
- | 115105..115329 | + | 225 | NuclAT_0 | - | - |
- | 115105..115329 | + | 225 | NuclAT_0 | - | - |
- | 115262..115327 | - | 66 | - | - | Antitoxin |
OH520_RS28305 | 115315..115464 | + | 150 | Protein_148 | plasmid maintenance protein Mok | - |
OH520_RS28310 | 115406..115531 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OH520_RS28315 | 115850..116146 | - | 297 | Protein_150 | hypothetical protein | - |
OH520_RS28320 | 116446..116742 | + | 297 | WP_001272251.1 | hypothetical protein | - |
OH520_RS28325 | 116853..117674 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OH520_RS28330 | 117971..118618 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OH520_RS28335 | 118895..119278 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OH520_RS28340 | 119469..120155 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OH520_RS28345 | 120249..120476 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..146158 | 146158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261106 WP_001372321.1 NZ_CP107400:115406-115531 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT261106 NZ_CP107400:c115327-115262 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|