Detailed information of TA system TA261106

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 115262..115531
• Replicon: plasmid unnamed2
• Accession: NZ_CP107400
• Organism: Klebsiella pneumoniae strain CRKP_26

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH520_RS28310
• Protein ID: WP_001372321.1
• Coordinates: 115406..115531 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	115262..115327 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH520_RS28280	110972..111499	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH520_RS28285	111557..111790	+	234	WP_000006003.1	DUF905 family protein	-
OH520_RS28290	111851..113874	+	2024	Protein_145	ParB/RepB/Spo0J family partition protein	-
OH520_RS28295	113943..114377	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH520_RS28300	114374..115093	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	115105..115329	+	225	NuclAT_0	-	-
-	115105..115329	+	225	NuclAT_0	-	-
-	115105..115329	+	225	NuclAT_0	-	-
-	115105..115329	+	225	NuclAT_0	-	-
-	115262..115327	-	66	-	-	Antitoxin
OH520_RS28305	115315..115464	+	150	Protein_148	plasmid maintenance protein Mok	-
OH520_RS28310	115406..115531	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH520_RS28315	115850..116146	-	297	Protein_150	hypothetical protein	-
OH520_RS28320	116446..116742	+	297	WP_001272251.1	hypothetical protein	-
OH520_RS28325	116853..117674	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH520_RS28330	117971..118618	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH520_RS28335	118895..119278	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH520_RS28340	119469..120155	+	687	WP_015059009.1	PAS domain-containing protein	-
OH520_RS28345	120249..120476	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..146158	146158

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261106 WP_001372321.1 NZ_CP107400:115406-115531 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT261106 NZ_CP107400:c115327-115262 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin