Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 115105..115531 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107400 | ||
| Organism | Klebsiella pneumoniae strain CRKP_26 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH520_RS28310 | Protein ID | WP_001372321.1 |
| Coordinates | 115406..115531 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 115105..115329 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH520_RS28275 (110209) | 110209..110670 | - | 462 | Protein_142 | hypothetical protein | - |
| OH520_RS28280 (110972) | 110972..111499 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH520_RS28285 (111557) | 111557..111790 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH520_RS28290 (111851) | 111851..113874 | + | 2024 | Protein_145 | ParB/RepB/Spo0J family partition protein | - |
| OH520_RS28295 (113943) | 113943..114377 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH520_RS28300 (114374) | 114374..115093 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - (115105) | 115105..115329 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115105) | 115105..115329 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115105) | 115105..115329 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (115105) | 115105..115329 | + | 225 | NuclAT_0 | - | Antitoxin |
| OH520_RS28305 (115315) | 115315..115464 | + | 150 | Protein_148 | plasmid maintenance protein Mok | - |
| OH520_RS28310 (115406) | 115406..115531 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH520_RS28315 (115850) | 115850..116146 | - | 297 | Protein_150 | hypothetical protein | - |
| OH520_RS28320 (116446) | 116446..116742 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OH520_RS28325 (116853) | 116853..117674 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH520_RS28330 (117971) | 117971..118618 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH520_RS28335 (118895) | 118895..119278 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH520_RS28340 (119469) | 119469..120155 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH520_RS28345 (120249) | 120249..120476 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..146158 | 146158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261105 WP_001372321.1 NZ_CP107400:115406-115531 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261105 NZ_CP107400:115105-115329 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|