Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78188..78441 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107395 | ||
| Organism | Klebsiella pneumoniae strain CRKP_27 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH529_RS27355 | Protein ID | WP_001312851.1 |
| Coordinates | 78188..78337 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78382..78441 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH529_RS27320 (73547) | 73547..73962 | - | 416 | Protein_90 | IS1-like element IS1B family transposase | - |
| OH529_RS27325 (74211) | 74211..74612 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH529_RS27330 (74545) | 74545..74802 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH529_RS27335 (74895) | 74895..75548 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH529_RS27340 (76487) | 76487..77344 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH529_RS27345 (77337) | 77337..77411 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH529_RS27350 (77656) | 77656..77904 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH529_RS27355 (78188) | 78188..78337 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (78382) | 78382..78441 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78382) | 78382..78441 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78382) | 78382..78441 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78382) | 78382..78441 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH529_RS27360 (78642) | 78642..78974 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH529_RS27365 (79036) | 79036..79635 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH529_RS27370 (80021) | 80021..80221 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH529_RS27375 (80353) | 80353..80913 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH529_RS27380 (80968) | 80968..81714 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH529_RS27385 (81734) | 81734..81934 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH529_RS27390 (81959) | 81959..82663 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH529_RS27395 (82716) | 82716..82781 | + | 66 | Protein_105 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154664 | 154664 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261078 WP_001312851.1 NZ_CP107395:c78337-78188 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261078 NZ_CP107395:78382-78441 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
