Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2397977..2398563 Replicon chromosome
Accession NZ_CP107394
Organism Klebsiella pneumoniae strain CRKP_27

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH529_RS11970 Protein ID WP_002920800.1
Coordinates 2397977..2398345 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OH529_RS11975 Protein ID WP_002920802.1
Coordinates 2398342..2398563 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH529_RS11950 2393480..2394550 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OH529_RS11955 2394552..2395397 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH529_RS11960 2395394..2396281 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH529_RS11965 2396388..2397704 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH529_RS11970 2397977..2398345 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH529_RS11975 2398342..2398563 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH529_RS11980 2398727..2399440 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH529_RS11985 2399442..2400209 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH529_RS11990 2400206..2401483 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OH529_RS11995 2401480..2402406 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2392743..2413331 20588


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T261068 WP_002920800.1 NZ_CP107394:c2398345-2397977 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT261068 WP_002920802.1 NZ_CP107394:c2398563-2398342 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References