Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79016..79269 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107391 | ||
| Organism | Klebsiella pneumoniae strain CRKP_28 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH501_RS27370 | Protein ID | WP_001312851.1 |
| Coordinates | 79016..79165 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79210..79269 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH501_RS27335 (74375) | 74375..74790 | - | 416 | Protein_92 | IS1-like element IS1B family transposase | - |
| OH501_RS27340 (75039) | 75039..75440 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH501_RS27345 (75373) | 75373..75630 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH501_RS27350 (75723) | 75723..76376 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH501_RS27355 (77315) | 77315..78172 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH501_RS27360 (78165) | 78165..78239 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH501_RS27365 (78484) | 78484..78732 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH501_RS27370 (79016) | 79016..79165 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79210) | 79210..79269 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79210) | 79210..79269 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79210) | 79210..79269 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79210) | 79210..79269 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH501_RS27375 (79470) | 79470..79802 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH501_RS27380 (79864) | 79864..80463 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH501_RS27385 (80849) | 80849..81049 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH501_RS27390 (81181) | 81181..81741 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH501_RS27395 (81796) | 81796..82542 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH501_RS27400 (82562) | 82562..82762 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH501_RS27405 (82787) | 82787..83491 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH501_RS27410 (83544) | 83544..83609 | + | 66 | Protein_107 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155492 | 155492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261055 WP_001312851.1 NZ_CP107391:c79165-79016 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261055 NZ_CP107391:79210-79269 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|