Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78743..78996 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107380 | ||
| Organism | Klebsiella pneumoniae strain CRKP_30 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH532_RS27415 | Protein ID | WP_001312851.1 |
| Coordinates | 78743..78892 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78937..78996 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH532_RS27380 (74102) | 74102..74517 | - | 416 | Protein_91 | IS1-like element IS1B family transposase | - |
| OH532_RS27385 (74766) | 74766..75167 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH532_RS27390 (75100) | 75100..75357 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH532_RS27395 (75450) | 75450..76103 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH532_RS27400 (77042) | 77042..77899 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH532_RS27405 (77892) | 77892..77966 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH532_RS27410 (78211) | 78211..78459 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH532_RS27415 (78743) | 78743..78892 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (78937) | 78937..78996 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78937) | 78937..78996 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78937) | 78937..78996 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78937) | 78937..78996 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH532_RS27420 (79197) | 79197..79529 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH532_RS27425 (79591) | 79591..80190 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH532_RS27430 (80576) | 80576..80776 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH532_RS27435 (80908) | 80908..81468 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH532_RS27440 (81523) | 81523..82269 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH532_RS27445 (82289) | 82289..82489 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH532_RS27450 (82514) | 82514..83218 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH532_RS27455 (83271) | 83271..83336 | + | 66 | Protein_106 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155820 | 155820 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261006 WP_001312851.1 NZ_CP107380:c78892-78743 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261006 NZ_CP107380:78937-78996 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|