Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37002..37428 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107380 | ||
| Organism | Klebsiella pneumoniae strain CRKP_30 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH532_RS27135 | Protein ID | WP_001372321.1 |
| Coordinates | 37002..37127 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 37204..37428 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH532_RS27100 (32057) | 32057..32284 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| OH532_RS27105 (32378) | 32378..33064 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH532_RS27110 (33255) | 33255..33638 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH532_RS27115 (33915) | 33915..34562 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH532_RS27120 (34859) | 34859..35680 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH532_RS27125 (35791) | 35791..36087 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| OH532_RS27130 (36387) | 36387..36683 | + | 297 | Protein_41 | hypothetical protein | - |
| OH532_RS27135 (37002) | 37002..37127 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH532_RS27140 (37069) | 37069..37218 | - | 150 | Protein_43 | plasmid maintenance protein Mok | - |
| - (37204) | 37204..37428 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37204) | 37204..37428 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37204) | 37204..37428 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37204) | 37204..37428 | - | 225 | NuclAT_0 | - | Antitoxin |
| OH532_RS27145 (37440) | 37440..38159 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| OH532_RS27150 (38156) | 38156..38590 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH532_RS27155 (38659) | 38659..40682 | - | 2024 | Protein_46 | ParB/RepB/Spo0J family partition protein | - |
| OH532_RS27160 (40743) | 40743..40976 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH532_RS27165 (41034) | 41034..41561 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH532_RS27170 (41863) | 41863..42324 | + | 462 | Protein_49 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155820 | 155820 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261003 WP_001372321.1 NZ_CP107380:c37127-37002 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261003 NZ_CP107380:c37428-37204 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|