Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 56134..56861 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107373 | ||
| Organism | Klebsiella pneumoniae strain CRKP_31 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OH494_RS27260 | Protein ID | WP_011251285.1 |
| Coordinates | 56134..56445 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OH494_RS27265 | Protein ID | WP_011251286.1 |
| Coordinates | 56442..56861 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH494_RS27230 | 52634..52864 | + | 231 | WP_011154571.1 | hypothetical protein | - |
| OH494_RS27235 | 53147..53311 | - | 165 | Protein_64 | Tn3 family transposase | - |
| OH494_RS27240 | 53449..53928 | + | 480 | WP_004212799.1 | cyclophilin-like fold protein | - |
| OH494_RS27245 | 53925..54725 | + | 801 | WP_228722687.1 | aldo/keto reductase | - |
| OH494_RS27255 | 55492..55929 | + | 438 | Protein_68 | DDE-type integrase/transposase/recombinase | - |
| OH494_RS27260 | 56134..56445 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OH494_RS27265 | 56442..56861 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OH494_RS27270 | 57008..57976 | + | 969 | WP_086642568.1 | IS5 family transposase | - |
| OH494_RS27275 | 58048..58413 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OH494_RS27280 | 58427..59215 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OH494_RS27285 | 59236..59856 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OH494_RS27290 | 60275..60910 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| OH494_RS27295 | 61223..61693 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..193835 | 193835 | |
| - | inside | IScluster/Tn | - | - | 54660..74490 | 19830 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260978 WP_011251285.1 NZ_CP107373:56134-56445 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260978 WP_011251286.1 NZ_CP107373:56442-56861 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|