Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 63253..63506 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107368 | ||
| Organism | Klebsiella pneumoniae strain CRKP_32 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH524_RS27240 | Protein ID | WP_001312851.1 |
| Coordinates | 63253..63402 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 63447..63506 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH524_RS27205 (58612) | 58612..59027 | - | 416 | Protein_71 | IS1-like element IS1B family transposase | - |
| OH524_RS27210 (59276) | 59276..59677 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH524_RS27215 (59610) | 59610..59867 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH524_RS27220 (59960) | 59960..60613 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH524_RS27225 (61552) | 61552..62409 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH524_RS27230 (62402) | 62402..62476 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH524_RS27235 (62721) | 62721..62969 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH524_RS27240 (63253) | 63253..63402 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (63447) | 63447..63506 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (63447) | 63447..63506 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (63447) | 63447..63506 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (63447) | 63447..63506 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH524_RS27245 (63707) | 63707..64039 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH524_RS27250 (64101) | 64101..64700 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH524_RS27255 (65086) | 65086..65286 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH524_RS27260 (65418) | 65418..65978 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH524_RS27265 (66033) | 66033..66779 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH524_RS27270 (66799) | 66799..66999 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH524_RS27275 (67024) | 67024..67728 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH524_RS27280 (67781) | 67781..67846 | + | 66 | Protein_86 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / catA2 | - | 1..152729 | 152729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260957 WP_001312851.1 NZ_CP107368:c63402-63253 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260957 NZ_CP107368:63447-63506 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
