Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 35745..36171 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107368 | ||
Organism | Klebsiella pneumoniae strain CRKP_32 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OH524_RS27050 | Protein ID | WP_001372321.1 |
Coordinates | 35745..35870 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 35947..36171 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH524_RS27015 (30800) | 30800..31027 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
OH524_RS27020 (31121) | 31121..31807 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OH524_RS27025 (31998) | 31998..32381 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OH524_RS27030 (32658) | 32658..33305 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OH524_RS27035 (33602) | 33602..34423 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OH524_RS27040 (34534) | 34534..34830 | - | 297 | WP_001272251.1 | hypothetical protein | - |
OH524_RS27045 (35130) | 35130..35426 | + | 297 | Protein_39 | hypothetical protein | - |
OH524_RS27050 (35745) | 35745..35870 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OH524_RS27055 (35812) | 35812..35961 | - | 150 | Protein_41 | plasmid maintenance protein Mok | - |
- (35947) | 35947..36171 | - | 225 | NuclAT_0 | - | Antitoxin |
- (35947) | 35947..36171 | - | 225 | NuclAT_0 | - | Antitoxin |
- (35947) | 35947..36171 | - | 225 | NuclAT_0 | - | Antitoxin |
- (35947) | 35947..36171 | - | 225 | NuclAT_0 | - | Antitoxin |
OH524_RS27060 (36183) | 36183..36902 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
OH524_RS27065 (36899) | 36899..37333 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OH524_RS27070 (37402) | 37402..39425 | - | 2024 | Protein_44 | ParB/RepB/Spo0J family partition protein | - |
OH524_RS27075 (39486) | 39486..39719 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
OH524_RS27080 (39777) | 39777..40304 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OH524_RS27085 (40606) | 40606..41073 | + | 468 | Protein_47 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / catA2 | - | 1..152729 | 152729 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260954 WP_001372321.1 NZ_CP107368:c35870-35745 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT260954 NZ_CP107368:c36171-35947 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|