Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2387698..2388284 | Replicon | chromosome |
Accession | NZ_CP107363 | ||
Organism | Klebsiella pneumoniae strain CRKP_33 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | OH511_RS11925 | Protein ID | WP_002920800.1 |
Coordinates | 2387698..2388066 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0H3GZM4 |
Locus tag | OH511_RS11930 | Protein ID | WP_002920802.1 |
Coordinates | 2388063..2388284 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH511_RS11905 | 2383201..2384271 | - | 1071 | WP_002920787.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
OH511_RS11910 | 2384273..2385118 | - | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
OH511_RS11915 | 2385115..2386002 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
OH511_RS11920 | 2386109..2387425 | - | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
OH511_RS11925 | 2387698..2388066 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OH511_RS11930 | 2388063..2388284 | - | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OH511_RS11935 | 2388448..2389161 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
OH511_RS11940 | 2389163..2389930 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
OH511_RS11945 | 2389927..2391204 | - | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
OH511_RS11950 | 2391201..2392127 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2382464..2403052 | 20588 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T260925 WP_002920800.1 NZ_CP107363:c2388066-2387698 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZM4 |