Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79032..79285 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107360 | ||
| Organism | Klebsiella pneumoniae strain CRKP_34 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH518_RS27410 | Protein ID | WP_001312851.1 |
| Coordinates | 79032..79181 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79226..79285 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH518_RS27375 (74391) | 74391..74806 | - | 416 | Protein_92 | IS1-like element IS1B family transposase | - |
| OH518_RS27380 (75055) | 75055..75456 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH518_RS27385 (75389) | 75389..75646 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH518_RS27390 (75739) | 75739..76392 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH518_RS27395 (77331) | 77331..78188 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH518_RS27400 (78181) | 78181..78255 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH518_RS27405 (78500) | 78500..78748 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH518_RS27410 (79032) | 79032..79181 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79226) | 79226..79285 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79226) | 79226..79285 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79226) | 79226..79285 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79226) | 79226..79285 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH518_RS27415 (79486) | 79486..79818 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH518_RS27420 (79880) | 79880..80479 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH518_RS27425 (80865) | 80865..81065 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH518_RS27430 (81197) | 81197..81757 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH518_RS27435 (81812) | 81812..82558 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH518_RS27440 (82578) | 82578..82778 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH518_RS27445 (82803) | 82803..83507 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH518_RS27450 (83560) | 83560..83625 | + | 66 | Protein_107 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155508 | 155508 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260912 WP_001312851.1 NZ_CP107360:c79181-79032 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260912 NZ_CP107360:79226-79285 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
