Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37279..37705 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107360 | ||
| Organism | Klebsiella pneumoniae strain CRKP_34 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH518_RS27130 | Protein ID | WP_001372321.1 |
| Coordinates | 37279..37404 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 37481..37705 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH518_RS27095 (32755) | 32755..33138 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH518_RS27100 (33415) | 33415..34062 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH518_RS27105 (34359) | 34359..34664 | - | 306 | Protein_38 | DUF932 domain-containing protein | - |
| OH518_RS27115 (35448) | 35448..35957 | - | 510 | Protein_40 | DUF932 domain-containing protein | - |
| OH518_RS27120 (36068) | 36068..36364 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| OH518_RS27125 (36664) | 36664..36960 | + | 297 | Protein_42 | hypothetical protein | - |
| OH518_RS27130 (37279) | 37279..37404 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH518_RS27135 (37346) | 37346..37495 | - | 150 | Protein_44 | plasmid maintenance protein Mok | - |
| - (37481) | 37481..37705 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37481) | 37481..37705 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37481) | 37481..37705 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (37481) | 37481..37705 | - | 225 | NuclAT_0 | - | Antitoxin |
| OH518_RS27140 (37717) | 37717..38436 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| OH518_RS27145 (38433) | 38433..38867 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH518_RS27150 (38936) | 38936..40959 | - | 2024 | Protein_47 | ParB/RepB/Spo0J family partition protein | - |
| OH518_RS27155 (41020) | 41020..41253 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH518_RS27160 (41311) | 41311..41838 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH518_RS27165 (42140) | 42140..42613 | + | 474 | Protein_50 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155508 | 155508 | |
| - | flank | IS/Tn | - | - | 34680..35057 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260909 WP_001372321.1 NZ_CP107360:c37404-37279 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT260909 NZ_CP107360:c37705-37481 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|