Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2951474..2952120 | Replicon | chromosome |
Accession | NZ_CP107352 | ||
Organism | Klebsiella pneumoniae strain CRKP_35 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483JFR4 |
Locus tag | OH515_RS14095 | Protein ID | WP_004188313.1 |
Coordinates | 2951474..2951821 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OH515_RS14100 | Protein ID | WP_135695834.1 |
Coordinates | 2951821..2952120 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH515_RS14085 (2947400) | 2947400..2948833 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
OH515_RS14090 (2948851) | 2948851..2951298 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
OH515_RS14095 (2951474) | 2951474..2951821 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH515_RS14100 (2951821) | 2951821..2952120 | + | 300 | WP_135695834.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OH515_RS14105 (2952183) | 2952183..2953691 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
OH515_RS14110 (2953896) | 2953896..2954225 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
OH515_RS14115 (2954276) | 2954276..2955106 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
OH515_RS14120 (2955156) | 2955156..2955914 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T260879 WP_004188313.1 NZ_CP107352:2951474-2951821 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|