Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2925286..2925872 Replicon chromosome
Accession NZ_CP107352
Organism Klebsiella pneumoniae strain CRKP_35

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH515_RS13985 Protein ID WP_002920800.1
Coordinates 2925504..2925872 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OH515_RS13980 Protein ID WP_004174006.1
Coordinates 2925286..2925507 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH515_RS13960 (2921443) 2921443..2922369 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OH515_RS13965 (2922366) 2922366..2923643 + 1278 WP_135695842.1 branched chain amino acid ABC transporter permease LivM -
OH515_RS13970 (2923640) 2923640..2924407 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH515_RS13975 (2924409) 2924409..2925122 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH515_RS13980 (2925286) 2925286..2925507 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH515_RS13985 (2925504) 2925504..2925872 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH515_RS13990 (2926145) 2926145..2927461 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH515_RS13995 (2927568) 2927568..2928455 + 888 WP_135695840.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH515_RS14000 (2928452) 2928452..2929297 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH515_RS14005 (2929299) 2929299..2930369 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2922366..2931106 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T260878 WP_002920800.1 NZ_CP107352:2925504-2925872 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT260878 WP_004174006.1 NZ_CP107352:2925286-2925507 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References