Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1186665..1187262 | Replicon | chromosome |
| Accession | NZ_CP107352 | ||
| Organism | Klebsiella pneumoniae strain CRKP_35 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | OH515_RS05660 | Protein ID | WP_004142563.1 |
| Coordinates | 1186945..1187262 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | OH515_RS05655 | Protein ID | WP_004142561.1 |
| Coordinates | 1186665..1186952 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH515_RS05625 (1182745) | 1182745..1182993 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| OH515_RS05630 (1183011) | 1183011..1183352 | - | 342 | WP_004848570.1 | RamA family antibiotic efflux transcriptional regulator | - |
| OH515_RS05635 (1183383) | 1183383..1184498 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| OH515_RS05640 (1184678) | 1184678..1185259 | + | 582 | WP_229408964.1 | TetR/AcrR family transcriptional regulator | - |
| OH515_RS05645 (1185259) | 1185259..1185627 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| OH515_RS05650 (1185747) | 1185747..1186400 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| OH515_RS05655 (1186665) | 1186665..1186952 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OH515_RS05660 (1186945) | 1186945..1187262 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH515_RS05665 (1187447) | 1187447..1188490 | - | 1044 | WP_065810347.1 | DUF2157 domain-containing protein | - |
| OH515_RS05670 (1189160) | 1189160..1190026 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| OH515_RS05675 (1190135) | 1190135..1191562 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T260874 WP_004142563.1 NZ_CP107352:c1187262-1186945 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |