Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45160..45413 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107342 | ||
| Organism | Klebsiella pneumoniae strain CRKP_37 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH503_RS28155 | Protein ID | WP_001312851.1 |
| Coordinates | 45160..45309 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 45354..45413 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH503_RS28120 (40519) | 40519..40934 | - | 416 | Protein_63 | IS1-like element IS1B family transposase | - |
| OH503_RS28125 (41183) | 41183..41584 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH503_RS28130 (41517) | 41517..41774 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH503_RS28135 (41867) | 41867..42520 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH503_RS28140 (43459) | 43459..44316 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH503_RS28145 (44309) | 44309..44383 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH503_RS28150 (44628) | 44628..44876 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH503_RS28155 (45160) | 45160..45309 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (45354) | 45354..45413 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45354) | 45354..45413 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45354) | 45354..45413 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45354) | 45354..45413 | + | 60 | NuclAT_0 | - | Antitoxin |
| OH503_RS28160 (45614) | 45614..45946 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH503_RS28165 (46008) | 46008..46607 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH503_RS28170 (46993) | 46993..47193 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH503_RS28175 (47325) | 47325..47885 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH503_RS28180 (47940) | 47940..48686 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH503_RS28185 (48706) | 48706..48906 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH503_RS28190 (48931) | 48931..49635 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH503_RS28195 (49688) | 49688..49753 | + | 66 | Protein_78 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 | - | 1..88043 | 88043 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260839 WP_001312851.1 NZ_CP107342:c45309-45160 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260839 NZ_CP107342:45354-45413 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|