Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3122590..3123176 Replicon chromosome
Accession NZ_CP107341
Organism Klebsiella pneumoniae strain CRKP_37

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH503_RS15365 Protein ID WP_002920800.1
Coordinates 3122808..3123176 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OH503_RS15360 Protein ID WP_002920802.1
Coordinates 3122590..3122811 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH503_RS15340 (3118747) 3118747..3119673 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OH503_RS15345 (3119670) 3119670..3120947 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OH503_RS15350 (3120944) 3120944..3121711 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH503_RS15355 (3121713) 3121713..3122426 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH503_RS15360 (3122590) 3122590..3122811 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH503_RS15365 (3122808) 3122808..3123176 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH503_RS15370 (3123449) 3123449..3124765 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH503_RS15375 (3124872) 3124872..3125759 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH503_RS15380 (3125756) 3125756..3126601 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH503_RS15385 (3126603) 3126603..3127673 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3119670..3128410 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T260834 WP_002920800.1 NZ_CP107341:3122808-3123176 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT260834 WP_002920802.1 NZ_CP107341:3122590-3122811 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References