Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 68069..68322 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107322 | ||
Organism | Klebsiella pneumoniae strain CRKP_40 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | OH527_RS28465 | Protein ID | WP_001312851.1 |
Coordinates | 68069..68218 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 68263..68322 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH527_RS28430 (63428) | 63428..63843 | - | 416 | Protein_84 | IS1-like element IS1B family transposase | - |
OH527_RS28435 (64092) | 64092..64493 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
OH527_RS28440 (64426) | 64426..64683 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
OH527_RS28445 (64776) | 64776..65429 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
OH527_RS28450 (66368) | 66368..67225 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
OH527_RS28455 (67218) | 67218..67292 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
OH527_RS28460 (67537) | 67537..67785 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
OH527_RS28465 (68069) | 68069..68218 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (68263) | 68263..68322 | + | 60 | NuclAT_1 | - | Antitoxin |
- (68263) | 68263..68322 | + | 60 | NuclAT_1 | - | Antitoxin |
- (68263) | 68263..68322 | + | 60 | NuclAT_1 | - | Antitoxin |
- (68263) | 68263..68322 | + | 60 | NuclAT_1 | - | Antitoxin |
OH527_RS28470 (68523) | 68523..68855 | - | 333 | WP_152916585.1 | hypothetical protein | - |
OH527_RS28475 (68917) | 68917..69516 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
OH527_RS28480 (69902) | 69902..70102 | - | 201 | WP_015059022.1 | hypothetical protein | - |
OH527_RS28485 (70234) | 70234..70794 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
OH527_RS28490 (70849) | 70849..71595 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
OH527_RS28495 (71615) | 71615..71815 | - | 201 | WP_072354025.1 | hypothetical protein | - |
OH527_RS28500 (71840) | 71840..72544 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
OH527_RS28505 (72596) | 72596..72940 | + | 345 | Protein_99 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | - | 1..134594 | 134594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260770 WP_001312851.1 NZ_CP107322:c68218-68069 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260770 NZ_CP107322:68263-68322 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|