Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31914..32340 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107322 | ||
| Organism | Klebsiella pneumoniae strain CRKP_40 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH527_RS28215 | Protein ID | WP_001372321.1 |
| Coordinates | 31914..32039 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 32116..32340 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH527_RS28185 (27182) | 27182..27886 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH527_RS28190 (28167) | 28167..28550 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH527_RS28195 (28827) | 28827..29474 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH527_RS28200 (29771) | 29771..30592 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH527_RS28205 (30703) | 30703..30999 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| OH527_RS28210 (31299) | 31299..31595 | + | 297 | Protein_40 | hypothetical protein | - |
| OH527_RS28215 (31914) | 31914..32039 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH527_RS28220 (31981) | 31981..32130 | - | 150 | Protein_42 | plasmid maintenance protein Mok | - |
| - (32116) | 32116..32340 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (32116) | 32116..32340 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (32116) | 32116..32340 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (32116) | 32116..32340 | - | 225 | NuclAT_0 | - | Antitoxin |
| OH527_RS28225 (32352) | 32352..33071 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| OH527_RS28230 (33068) | 33068..33502 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH527_RS28235 (33571) | 33571..35594 | - | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
| OH527_RS28240 (35655) | 35655..35888 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH527_RS28245 (35946) | 35946..36473 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH527_RS28250 (36775) | 36775..37224 | + | 450 | Protein_48 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | - | 1..134594 | 134594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260767 WP_001372321.1 NZ_CP107322:c32039-31914 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT260767 NZ_CP107322:c32340-32116 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|