Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 85934..86661 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107314 | ||
| Organism | Klebsiella pneumoniae strain CRKP_41 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OH506_RS28830 | Protein ID | WP_011251285.1 |
| Coordinates | 86350..86661 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OH506_RS28825 | Protein ID | WP_011251286.1 |
| Coordinates | 85934..86353 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH506_RS28795 | 81102..81572 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| OH506_RS28800 | 81885..82520 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| OH506_RS28805 | 82939..83559 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OH506_RS28810 | 83580..84368 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| OH506_RS28815 | 84382..84747 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| OH506_RS28820 | 84819..85787 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| OH506_RS28825 | 85934..86353 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OH506_RS28830 | 86350..86661 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OH506_RS28835 | 86866..87303 | - | 438 | Protein_104 | DDE-type integrase/transposase/recombinase | - |
| OH506_RS28840 | 87438..88135 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| OH506_RS28845 | 88137..88586 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| OH506_RS28850 | 88603..88914 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| OH506_RS28855 | 88928..89269 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| OH506_RS28860 | 89329..90285 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| OH506_RS28865 | 90710..91150 | - | 441 | WP_011251275.1 | hypothetical protein | - |
| OH506_RS28870 | 91156..91650 | - | 495 | WP_011251274.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..126785 | 126785 | |
| - | inside | IScluster/Tn | - | - | 80112..93570 | 13458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260746 WP_011251285.1 NZ_CP107314:c86661-86350 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260746 WP_011251286.1 NZ_CP107314:c86353-85934 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|