Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 74813..75066 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107313 | ||
| Organism | Klebsiella pneumoniae strain CRKP_41 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH506_RS27815 | Protein ID | WP_001312851.1 |
| Coordinates | 74813..74962 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 75007..75066 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH506_RS27780 (70172) | 70172..70587 | - | 416 | Protein_88 | IS1-like element IS1B family transposase | - |
| OH506_RS27785 (70836) | 70836..71237 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH506_RS27790 (71170) | 71170..71427 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH506_RS27795 (71520) | 71520..72173 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH506_RS27800 (73112) | 73112..73969 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH506_RS27805 (73962) | 73962..74036 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH506_RS27810 (74281) | 74281..74529 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH506_RS27815 (74813) | 74813..74962 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (75007) | 75007..75066 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (75007) | 75007..75066 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (75007) | 75007..75066 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (75007) | 75007..75066 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH506_RS27820 (75267) | 75267..75599 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH506_RS27825 (75661) | 75661..76260 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH506_RS27830 (76646) | 76646..76846 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH506_RS27835 (76978) | 76978..77538 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH506_RS27840 (77593) | 77593..78339 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH506_RS27845 (78359) | 78359..78559 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH506_RS27850 (78584) | 78584..79288 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH506_RS27855 (79340) | 79340..79684 | + | 345 | Protein_103 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 | - | 1..146891 | 146891 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260739 WP_001312851.1 NZ_CP107313:c74962-74813 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260739 NZ_CP107313:75007-75066 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
