Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38652..39078 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107313 | ||
| Organism | Klebsiella pneumoniae strain CRKP_41 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH506_RS27570 | Protein ID | WP_001372321.1 |
| Coordinates | 38652..38777 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 38854..39078 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH506_RS27535 (33707) | 33707..33934 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| OH506_RS27540 (34028) | 34028..34714 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH506_RS27545 (34905) | 34905..35288 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH506_RS27550 (35565) | 35565..36212 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH506_RS27555 (36509) | 36509..37330 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH506_RS27560 (37441) | 37441..37737 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| OH506_RS27565 (38037) | 38037..38333 | + | 297 | Protein_45 | hypothetical protein | - |
| OH506_RS27570 (38652) | 38652..38777 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH506_RS27575 (38719) | 38719..38868 | - | 150 | Protein_47 | plasmid maintenance protein Mok | - |
| - (38854) | 38854..39078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (38854) | 38854..39078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (38854) | 38854..39078 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (38854) | 38854..39078 | - | 225 | NuclAT_0 | - | Antitoxin |
| OH506_RS27580 (39090) | 39090..39809 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| OH506_RS27585 (39806) | 39806..40240 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH506_RS27590 (40309) | 40309..42332 | - | 2024 | Protein_50 | ParB/RepB/Spo0J family partition protein | - |
| OH506_RS27595 (42393) | 42393..42626 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH506_RS27600 (42684) | 42684..43211 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH506_RS27605 (43513) | 43513..43968 | + | 456 | Protein_53 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 | - | 1..146891 | 146891 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260736 WP_001372321.1 NZ_CP107313:c38777-38652 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT260736 NZ_CP107313:c39078-38854 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
