Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 50922..51175 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107304 | ||
Organism | Klebsiella pneumoniae strain CRKP_43 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | OH504_RS27300 | Protein ID | WP_001312851.1 |
Coordinates | 51026..51175 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 50922..50981 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH504_RS27260 (46514) | 46514..46648 | + | 135 | Protein_63 | Tn3 family transposase | - |
OH504_RS27265 (46700) | 46700..47404 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
OH504_RS27270 (47429) | 47429..47629 | + | 201 | WP_072354025.1 | hypothetical protein | - |
OH504_RS27275 (47649) | 47649..48395 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
OH504_RS27280 (48450) | 48450..49010 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
OH504_RS27285 (49142) | 49142..49342 | + | 201 | WP_015059022.1 | hypothetical protein | - |
OH504_RS27290 (49728) | 49728..50327 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
OH504_RS27295 (50389) | 50389..50721 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (50922) | 50922..50981 | - | 60 | NuclAT_0 | - | Antitoxin |
- (50922) | 50922..50981 | - | 60 | NuclAT_0 | - | Antitoxin |
- (50922) | 50922..50981 | - | 60 | NuclAT_0 | - | Antitoxin |
- (50922) | 50922..50981 | - | 60 | NuclAT_0 | - | Antitoxin |
OH504_RS27300 (51026) | 51026..51175 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
OH504_RS27305 (51459) | 51459..51707 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
OH504_RS27310 (51952) | 51952..52026 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
OH504_RS27315 (52019) | 52019..52876 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
OH504_RS27320 (53815) | 53815..54468 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
OH504_RS27325 (54561) | 54561..54818 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
OH504_RS27330 (54751) | 54751..55152 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
OH504_RS27335 (55401) | 55401..55816 | + | 416 | Protein_78 | IS1-like element IS1B family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..103669 | 103669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260694 WP_001312851.1 NZ_CP107304:51026-51175 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260694 NZ_CP107304:c50981-50922 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|