Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 106765..107018 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107299 | ||
Organism | Klebsiella pneumoniae strain CRKP_44 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | OH517_RS29400 | Protein ID | WP_001312851.1 |
Coordinates | 106869..107018 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 106765..106824 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH517_RS29360 (102147) | 102147..102491 | - | 345 | Protein_141 | IS6-like element IS26 family transposase | - |
OH517_RS29365 (102543) | 102543..103247 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
OH517_RS29370 (103272) | 103272..103472 | + | 201 | WP_072354025.1 | hypothetical protein | - |
OH517_RS29375 (103492) | 103492..104238 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
OH517_RS29380 (104293) | 104293..104853 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
OH517_RS29385 (104985) | 104985..105185 | + | 201 | WP_015059022.1 | hypothetical protein | - |
OH517_RS29390 (105571) | 105571..106170 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
OH517_RS29395 (106232) | 106232..106564 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (106765) | 106765..106824 | - | 60 | NuclAT_1 | - | Antitoxin |
- (106765) | 106765..106824 | - | 60 | NuclAT_1 | - | Antitoxin |
- (106765) | 106765..106824 | - | 60 | NuclAT_1 | - | Antitoxin |
- (106765) | 106765..106824 | - | 60 | NuclAT_1 | - | Antitoxin |
OH517_RS29400 (106869) | 106869..107018 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
OH517_RS29405 (107302) | 107302..107550 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
OH517_RS29410 (107795) | 107795..107869 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
OH517_RS29415 (107862) | 107862..108719 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
OH517_RS29420 (109658) | 109658..110311 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
OH517_RS29425 (110404) | 110404..110661 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
OH517_RS29430 (110594) | 110594..110995 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
OH517_RS29435 (111244) | 111244..111659 | + | 416 | Protein_156 | IS1-like element IS1B family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 / blaCTX-M-65 / tet(A) / blaLAP-2 / qnrS1 / dfrA14 / sul2 / fosA3 | - | 1..215446 | 215446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260676 WP_001312851.1 NZ_CP107299:106869-107018 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260676 NZ_CP107299:c106824-106765 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|