Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 23946..24215 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107299 | ||
| Organism | Klebsiella pneumoniae strain CRKP_44 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH517_RS28815 | Protein ID | WP_001372321.1 |
| Coordinates | 24090..24215 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 23946..24011 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH517_RS28785 | 19656..20183 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH517_RS28790 | 20241..20474 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH517_RS28795 | 20535..22558 | + | 2024 | Protein_28 | ParB/RepB/Spo0J family partition protein | - |
| OH517_RS28800 | 22627..23061 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH517_RS28805 | 23058..23777 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 23789..24013 | + | 225 | NuclAT_0 | - | - |
| - | 23789..24013 | + | 225 | NuclAT_0 | - | - |
| - | 23789..24013 | + | 225 | NuclAT_0 | - | - |
| - | 23789..24013 | + | 225 | NuclAT_0 | - | - |
| - | 23946..24011 | - | 66 | - | - | Antitoxin |
| OH517_RS28810 | 23999..24148 | + | 150 | Protein_31 | plasmid maintenance protein Mok | - |
| OH517_RS28815 | 24090..24215 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH517_RS28820 | 24534..24830 | - | 297 | Protein_33 | hypothetical protein | - |
| OH517_RS28825 | 25130..25426 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OH517_RS28830 | 25537..26358 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH517_RS28835 | 26655..27302 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH517_RS28840 | 27579..27962 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH517_RS28845 | 28153..28839 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH517_RS28850 | 28933..29160 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 / blaCTX-M-65 / tet(A) / blaLAP-2 / qnrS1 / dfrA14 / sul2 / fosA3 | - | 1..215446 | 215446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260673 WP_001372321.1 NZ_CP107299:24090-24215 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT260673 NZ_CP107299:c24011-23946 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|