Detailed information of TA system TA260672

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 23789..24215
• Replicon: plasmid unnamed2
• Accession: NZ_CP107299
• Organism: Klebsiella pneumoniae strain CRKP_44

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH517_RS28815
• Protein ID: WP_001372321.1
• Coordinates: 24090..24215 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	23789..24013 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH517_RS28780 (18899)	18899..19354	-	456	Protein_25	hypothetical protein	-
OH517_RS28785 (19656)	19656..20183	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH517_RS28790 (20241)	20241..20474	+	234	WP_000006003.1	DUF905 family protein	-
OH517_RS28795 (20535)	20535..22558	+	2024	Protein_28	ParB/RepB/Spo0J family partition protein	-
OH517_RS28800 (22627)	22627..23061	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH517_RS28805 (23058)	23058..23777	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (23789)	23789..24013	+	225	NuclAT_0	-	Antitoxin
- (23789)	23789..24013	+	225	NuclAT_0	-	Antitoxin
- (23789)	23789..24013	+	225	NuclAT_0	-	Antitoxin
- (23789)	23789..24013	+	225	NuclAT_0	-	Antitoxin
OH517_RS28810 (23999)	23999..24148	+	150	Protein_31	plasmid maintenance protein Mok	-
OH517_RS28815 (24090)	24090..24215	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH517_RS28820 (24534)	24534..24830	-	297	Protein_33	hypothetical protein	-
OH517_RS28825 (25130)	25130..25426	+	297	WP_001272251.1	hypothetical protein	-
OH517_RS28830 (25537)	25537..26358	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH517_RS28835 (26655)	26655..27302	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH517_RS28840 (27579)	27579..27962	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH517_RS28845 (28153)	28153..28839	+	687	WP_015059009.1	PAS domain-containing protein	-
OH517_RS28850 (28933)	28933..29160	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 / blaCTX-M-65 / tet(A) / blaLAP-2 / qnrS1 / dfrA14 / sul2 / fosA3	-	1..215446	215446

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T260672 WP_001372321.1 NZ_CP107299:24090-24215 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT260672 NZ_CP107299:23789-24013 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin