Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 212781..213508 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107298 | ||
| Organism | Klebsiella pneumoniae strain CRKP_44 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OH517_RS28620 | Protein ID | WP_011251285.1 |
| Coordinates | 212781..213092 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OH517_RS28625 | Protein ID | WP_011251286.1 |
| Coordinates | 213089..213508 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH517_RS28580 | 207792..208286 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| OH517_RS28585 | 208292..208732 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| OH517_RS28590 | 209157..210113 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| OH517_RS28595 | 210173..210514 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| OH517_RS28600 | 210528..210839 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| OH517_RS28605 | 210856..211305 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| OH517_RS28615 | 212139..212576 | + | 438 | Protein_230 | DDE-type integrase/transposase/recombinase | - |
| OH517_RS28620 | 212781..213092 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OH517_RS28625 | 213089..213508 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OH517_RS28630 | 213655..214623 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| OH517_RS28635 | 214695..215060 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OH517_RS28640 | 215074..215862 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OH517_RS28645 | 215883..216503 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OH517_RS28650 | 216922..217557 | + | 636 | WP_223171879.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..217869 | 217869 | |
| - | inside | IScluster/Tn | - | - | 205872..214623 | 8751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260671 WP_011251285.1 NZ_CP107298:212781-213092 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260671 WP_011251286.1 NZ_CP107298:213089-213508 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|