260663

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3845076..3845662 Replicon chromosome
Accession NZ_CP107297
Organism Klebsiella pneumoniae strain CRKP_44

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH517_RS19480 Protein ID WP_002920800.1
Coordinates 3845076..3845444 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OH517_RS19485 Protein ID WP_002920802.1
Coordinates 3845441..3845662 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH517_RS19460 3840579..3841649 - 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
OH517_RS19465 3841651..3842496 - 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH517_RS19470 3842493..3843380 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH517_RS19475 3843487..3844803 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH517_RS19480 3845076..3845444 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH517_RS19485 3845441..3845662 - 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH517_RS19490 3845826..3846539 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH517_RS19495 3846541..3847308 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH517_RS19500 3847305..3848582 - 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OH517_RS19505 3848579..3849505 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3839842..3848582 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T260663 WP_002920800.1 NZ_CP107297:c3845444-3845076 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT260663 WP_002920802.1 NZ_CP107297:c3845662-3845441 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References