Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3818827..3819473 | Replicon | chromosome |
Accession | NZ_CP107297 | ||
Organism | Klebsiella pneumoniae strain CRKP_44 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W8UNE1 |
Locus tag | OH517_RS19370 | Protein ID | WP_002920560.1 |
Coordinates | 3819126..3819473 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | OH517_RS19365 | Protein ID | WP_002920557.1 |
Coordinates | 3818827..3819126 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH517_RS19345 | 3815033..3815791 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
OH517_RS19350 | 3815841..3816671 | - | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
OH517_RS19355 | 3816722..3817051 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
OH517_RS19360 | 3817256..3818764 | + | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
OH517_RS19365 | 3818827..3819126 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OH517_RS19370 | 3819126..3819473 | - | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH517_RS19375 | 3819649..3822096 | - | 2448 | WP_163622888.1 | glycogen phosphorylase | - |
OH517_RS19380 | 3822114..3823547 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T260662 WP_002920560.1 NZ_CP107297:c3819473-3819126 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |