Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3431470..3432245 | Replicon | chromosome |
| Accession | NZ_CP107297 | ||
| Organism | Klebsiella pneumoniae strain CRKP_44 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | OH517_RS17300 | Protein ID | WP_004150910.1 |
| Coordinates | 3431470..3431955 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | OH517_RS17305 | Protein ID | WP_004150912.1 |
| Coordinates | 3431952..3432245 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH517_RS17275 | 3426639..3428006 | - | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
| OH517_RS17280 | 3427999..3428382 | - | 384 | WP_004150906.1 | hypothetical protein | - |
| OH517_RS17285 | 3428382..3429254 | - | 873 | WP_004188557.1 | ParA family protein | - |
| OH517_RS17290 | 3429860..3430076 | - | 217 | Protein_3396 | transposase | - |
| OH517_RS17295 | 3430173..3430766 | - | 594 | WP_004188553.1 | hypothetical protein | - |
| OH517_RS17300 | 3431470..3431955 | - | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| OH517_RS17305 | 3431952..3432245 | - | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| OH517_RS17310 | 3432890..3434266 | + | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| OH517_RS17315 | 3434277..3435425 | + | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| OH517_RS17320 | 3435426..3436337 | - | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| OH517_RS17325 | 3436435..3437037 | + | 603 | WP_062954968.1 | short chain dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | - | 3373250..3432496 | 59246 | ||
| flank | IS/Tn | - | - | 3429924..3430076 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T260661 WP_004150910.1 NZ_CP107297:c3431955-3431470 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |