Detailed information of TA system TA260650

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 186618..187044
• Replicon: plasmid unnamed2
• Accession: NZ_CP107293
• Organism: Klebsiella pneumoniae strain CRKP_45

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH513_RS29835
• Protein ID: WP_001372321.1
• Coordinates: 186618..186743 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	186820..187044 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH513_RS29800 (181673)	181673..181900	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
OH513_RS29805 (181994)	181994..182680	-	687	WP_015059009.1	PAS domain-containing protein	-
OH513_RS29810 (182871)	182871..183254	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH513_RS29815 (183531)	183531..184178	+	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH513_RS29820 (184475)	184475..185296	-	822	WP_001234445.1	DUF932 domain-containing protein	-
OH513_RS29825 (185407)	185407..185703	-	297	WP_001272251.1	hypothetical protein	-
OH513_RS29830 (186003)	186003..186299	+	297	Protein_237	hypothetical protein	-
OH513_RS29835 (186618)	186618..186743	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH513_RS29840 (186685)	186685..186834	-	150	Protein_239	plasmid maintenance protein Mok	-
- (186820)	186820..187044	-	225	NuclAT_0	-	Antitoxin
- (186820)	186820..187044	-	225	NuclAT_0	-	Antitoxin
- (186820)	186820..187044	-	225	NuclAT_0	-	Antitoxin
- (186820)	186820..187044	-	225	NuclAT_0	-	Antitoxin
OH513_RS29845 (187056)	187056..187775	-	720	WP_001276217.1	plasmid SOS inhibition protein A	-
OH513_RS29850 (187772)	187772..188206	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH513_RS29855 (188275)	188275..190298	-	2024	Protein_242	ParB/RepB/Spo0J family partition protein	-
OH513_RS29860 (190359)	190359..190592	-	234	WP_000006003.1	DUF905 family protein	-
OH513_RS29865 (190650)	190650..191177	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH513_RS29870 (191479)	191479..191934	+	456	Protein_245	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	rmtB / blaTEM-1B / fosA3 / sul2 / dfrA14 / qnrS1 / blaLAP-2 / tet(A) / blaCTX-M-65 / blaKPC-2 / blaSHV-12	-	1..205511	205511

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T260650 WP_001372321.1 NZ_CP107293:c186743-186618 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT260650 NZ_CP107293:c187044-186820 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin