Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 104062..104315 Replicon plasmid unnamed2
Accession NZ_CP107293
Organism Klebsiella pneumoniae strain CRKP_45

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag OH513_RS29245 Protein ID WP_001312851.1
Coordinates 104062..104211 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 104256..104315 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH513_RS29210 (99421) 99421..99836 - 416 Protein_113 IS1-like element IS1B family transposase -
OH513_RS29215 (100085) 100085..100486 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
OH513_RS29220 (100419) 100419..100676 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
OH513_RS29225 (100769) 100769..101422 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
OH513_RS29230 (102361) 102361..103218 - 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
OH513_RS29235 (103211) 103211..103285 - 75 WP_001375168.1 RepA leader peptide Tap -
OH513_RS29240 (103530) 103530..103778 - 249 WP_000083837.1 replication regulatory protein RepA -
OH513_RS29245 (104062) 104062..104211 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (104256) 104256..104315 + 60 NuclAT_1 - Antitoxin
- (104256) 104256..104315 + 60 NuclAT_1 - Antitoxin
- (104256) 104256..104315 + 60 NuclAT_1 - Antitoxin
- (104256) 104256..104315 + 60 NuclAT_1 - Antitoxin
OH513_RS29250 (104516) 104516..104848 - 333 WP_152916585.1 hypothetical protein -
OH513_RS29255 (104910) 104910..105509 - 600 WP_032083981.1 PIN domain-containing protein -
OH513_RS29260 (105895) 105895..106095 - 201 WP_015059022.1 hypothetical protein -
OH513_RS29265 (106227) 106227..106787 - 561 WP_000139328.1 fertility inhibition protein FinO -
OH513_RS29270 (106842) 106842..107588 - 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
OH513_RS29275 (107608) 107608..107808 - 201 WP_072354025.1 hypothetical protein -
OH513_RS29280 (107833) 107833..108042 + 210 Protein_127 IS6 family transposase -
OH513_RS29285 (108194) 108194..108437 + 244 Protein_128 DDE-type integrase/transposase/recombinase -
OH513_RS29290 (108506) 108506..108660 + 155 Protein_129 IS6 family transposase -
OH513_RS29295 (108741) 108741..109106 - 366 Protein_130 type IV conjugative transfer system protein TraE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtB / blaTEM-1B / fosA3 / sul2 / dfrA14 / qnrS1 / blaLAP-2 / tet(A) / blaCTX-M-65 / blaKPC-2 / blaSHV-12 - 1..205511 205511


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T260645 WP_001312851.1 NZ_CP107293:c104211-104062 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT260645 NZ_CP107293:104256-104315 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References