Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4191406..4191664 | Replicon | chromosome |
| Accession | NZ_CP107284 | ||
| Organism | Escherichia coli strain SW4848 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | OF379_RS20185 | Protein ID | WP_000809168.1 |
| Coordinates | 4191512..4191664 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4191406..4191463 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF379_RS20170 | 4187798..4188757 | + | 960 | WP_000871682.1 | hypothetical protein | - |
| OF379_RS20175 | 4188795..4189694 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| OF379_RS20180 | 4189760..4190926 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 4191406..4191463 | - | 58 | - | - | Antitoxin |
| OF379_RS20185 | 4191512..4191664 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| OF379_RS20190 | 4191768..4192898 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| OF379_RS20195 | 4192987..4194903 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| OF379_RS20200 | 4195279..4195683 | + | 405 | WP_000843579.1 | DUF2541 family protein | - |
| OF379_RS20205 | 4195709..4196422 | + | 714 | WP_001102367.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T260618 WP_000809168.1 NZ_CP107284:4191512-4191664 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT260618 NZ_CP107284:c4191463-4191406 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|