Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3914517..3915211 Replicon chromosome
Accession NZ_CP107284
Organism Escherichia coli strain SW4848

Toxin (Protein)


Gene name yafO Uniprot ID A0A1X0YXS1
Locus tag OF379_RS18935 Protein ID WP_001263484.1
Coordinates 3914517..3914915 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag OF379_RS18940 Protein ID WP_000554755.1
Coordinates 3914918..3915211 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3910347) 3910347..3910427 - 81 NuclAT_8 - -
- (3910347) 3910347..3910427 - 81 NuclAT_8 - -
- (3910347) 3910347..3910427 - 81 NuclAT_8 - -
- (3910347) 3910347..3910427 - 81 NuclAT_8 - -
OF379_RS18905 (3909687) 3909687..3910931 - 1245 WP_000189541.1 esterase FrsA -
OF379_RS18910 (3911023) 3911023..3911481 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
OF379_RS18915 (3911742) 3911742..3913199 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
OF379_RS18920 (3913256) 3913256..3913608 - 353 Protein_3705 peptide chain release factor H -
OF379_RS18925 (3913604) 3913604..3913810 - 207 Protein_3706 RtcB family protein -
OF379_RS18930 (3914055) 3914055..3914507 - 453 WP_001059899.1 GNAT family N-acetyltransferase -
OF379_RS18935 (3914517) 3914517..3914915 - 399 WP_001263484.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
OF379_RS18940 (3914918) 3914918..3915211 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
OF379_RS18945 (3915263) 3915263..3916318 - 1056 WP_001226183.1 DNA polymerase IV -
OF379_RS18950 (3916389) 3916389..3917174 - 786 WP_000207554.1 putative lateral flagellar export/assembly protein LafU -
OF379_RS18955 (3917146) 3917146..3918858 + 1713 Protein_3712 flagellar biosynthesis protein FlhA -
OF379_RS18960 (3918963) 3918963..3919241 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
OF379_RS18965 (3919234) 3919234..3919590 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15404.81 Da        Isoelectric Point: 7.3840

>T260617 WP_001263484.1 NZ_CP107284:c3914915-3914517 [Escherichia coli]
MRVFKTKLICLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT260617 WP_000554755.1 NZ_CP107284:c3915211-3914918 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X0YXS1

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References