Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 628286..629085 | Replicon | chromosome |
| Accession | NZ_CP107284 | ||
| Organism | Escherichia coli strain SW4848 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A7B2BI69 |
| Locus tag | OF379_RS02990 | Protein ID | WP_000347258.1 |
| Coordinates | 628286..628750 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A368IY36 |
| Locus tag | OF379_RS02995 | Protein ID | WP_001604880.1 |
| Coordinates | 628750..629085 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF379_RS02960 (623287) | 623287..623721 | - | 435 | WP_000948829.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| OF379_RS02965 (623739) | 623739..624617 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| OF379_RS02970 (624607) | 624607..625386 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| OF379_RS02975 (625397) | 625397..625870 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| OF379_RS02980 (625893) | 625893..627173 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| OF379_RS02985 (627422) | 627422..628231 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| OF379_RS02990 (628286) | 628286..628750 | - | 465 | WP_000347258.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| OF379_RS02995 (628750) | 628750..629085 | - | 336 | WP_001604880.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| OF379_RS03000 (629234) | 629234..630805 | - | 1572 | WP_001273737.1 | galactarate dehydratase | - |
| OF379_RS03005 (631180) | 631180..632514 | + | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
| OF379_RS03010 (632530) | 632530..633300 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.32 Da Isoelectric Point: 9.6924
>T260606 WP_000347258.1 NZ_CP107284:c628750-628286 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7B2BI69 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A368IY36 |