Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 4643300..4644075 Replicon chromosome
Accession NZ_CP107275
Organism Pseudomonas aeruginosa strain PALA22

Toxin (Protein)


Gene name yhaV Uniprot ID V6ADY6
Locus tag PALA22_RS21505 Protein ID WP_009518525.1
Coordinates 4643300..4643758 (-) Length 153 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID V6AEP7
Locus tag PALA22_RS21510 Protein ID WP_023098543.1
Coordinates 4643758..4644075 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA22_RS21480 (PALA22_04263) 4638641..4639588 + 948 WP_023108457.1 TIGR03756 family integrating conjugative element protein -
PALA22_RS21485 (PALA22_04264) 4639598..4640992 + 1395 WP_009518521.1 integrating conjugative element protein -
PALA22_RS21490 (PALA22_04265) 4640989..4641348 + 360 WP_009518522.1 hypothetical protein -
PALA22_RS21495 (PALA22_04266) 4641363..4642880 + 1518 WP_033961861.1 conjugal transfer protein TraG N-terminal domain-containing protein -
PALA22_RS21500 (PALA22_04267) 4642896..4643273 - 378 WP_033961863.1 DUF3742 family protein -
PALA22_RS21505 (PALA22_04268) 4643300..4643758 - 459 WP_009518525.1 type II toxin-antitoxin system YhaV family toxin Toxin
PALA22_RS21510 (PALA22_04269) 4643758..4644075 - 318 WP_023098543.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
PALA22_RS21515 (PALA22_04270) 4644375..4646192 + 1818 WP_033961866.1 MobH family relaxase -
PALA22_RS21520 4646174..4646395 - 222 WP_099459023.1 MerR family DNA-binding transcriptional regulator -
PALA22_RS21525 (PALA22_04271) 4646469..4647380 - 912 WP_003090227.1 NAD(P)H-binding protein -
PALA22_RS21530 4647454..4647651 - 198 WP_023108461.1 hypothetical protein -
PALA22_RS21535 4647602..4647934 + 333 WP_228380005.1 redox-sensitive transcriptional activator SoxR -
PALA22_RS21540 (PALA22_04272) 4648169..4648591 - 423 WP_003090234.1 MerR family DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4581732..4701582 119850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(8-144)

Antitoxin

PrlF antitoxin

(8-100)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17660.02 Da        Isoelectric Point: 10.1848

>T260600 WP_009518525.1 NZ_CP107275:c4643758-4643300 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE

Download         Length: 459 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11170.72 Da        Isoelectric Point: 4.7182

>AT260600 WP_023098543.1 NZ_CP107275:c4644075-4643758 [Pseudomonas aeruginosa]
MPAIHEVATLTSKGQITLPKPIRQALGVDAGGKLAFDLRGSEVVVTRVDAEHEDPAIGAFLSLLARDIEAGRNVRGLPED
LARAMLEHAGHGVNLDEEIDGKVEL

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V6ADY6

Antitoxin

Source ID Structure
AlphaFold DB V6AEP7

References