Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2291985..2292666 | Replicon | chromosome |
Accession | NZ_CP107275 | ||
Organism | Pseudomonas aeruginosa strain PALA22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | PALA22_RS10680 | Protein ID | WP_003111825.1 |
Coordinates | 2291985..2292350 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
Locus tag | PALA22_RS10685 | Protein ID | WP_003159602.1 |
Coordinates | 2292343..2292666 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA22_RS10650 (PALA22_02115) | 2287949..2288383 | - | 435 | WP_003158601.1 | RidA family protein | - |
PALA22_RS10655 (PALA22_02116) | 2288604..2289557 | + | 954 | WP_034012959.1 | LysR substrate-binding domain-containing protein | - |
PALA22_RS10660 (PALA22_02117) | 2289530..2290414 | - | 885 | WP_034012956.1 | LysR family transcriptional regulator | - |
PALA22_RS10665 (PALA22_02118) | 2290515..2290940 | + | 426 | WP_003158599.1 | VOC family protein | - |
PALA22_RS10670 (PALA22_02119) | 2290971..2291243 | - | 273 | WP_003085667.1 | hypothetical protein | - |
PALA22_RS10675 | 2291450..2291692 | + | 243 | WP_043884955.1 | hypothetical protein | - |
PALA22_RS10680 | 2291985..2292350 | + | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA22_RS10685 (PALA22_02120) | 2292343..2292666 | + | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
PALA22_RS10690 (PALA22_02121) | 2293042..2294130 | - | 1089 | WP_031652783.1 | DUF3396 domain-containing protein | - |
PALA22_RS10695 (PALA22_02122) | 2294147..2294848 | - | 702 | WP_030046795.1 | VRR-NUC domain-containing protein | - |
PALA22_RS10700 (PALA22_02123) | 2294845..2295363 | - | 519 | WP_034012953.1 | PAAR domain-containing protein | - |
PALA22_RS10705 (PALA22_02124) | 2295537..2295872 | - | 336 | WP_263919420.1 | TM2 domain-containing protein | - |
PALA22_RS10710 (PALA22_02125) | 2296115..2296753 | - | 639 | WP_034012950.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2234585..2295872 | 61287 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T260596 WP_003111825.1 NZ_CP107275:2291985-2292350 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6AKP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BMJ2 |