Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1551117..1551712 | Replicon | chromosome |
Accession | NZ_CP107275 | ||
Organism | Pseudomonas aeruginosa strain PALA22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA22_RS07155 | Protein ID | WP_003113526.1 |
Coordinates | 1551117..1551395 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA22_RS07160 | Protein ID | WP_003099268.1 |
Coordinates | 1551407..1551712 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA22_RS07135 (PALA22_01420) | 1546543..1547781 | + | 1239 | WP_017001387.1 | C69 family dipeptidase | - |
PALA22_RS07140 (PALA22_01421) | 1547843..1548490 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA22_RS07145 (PALA22_01422) | 1548560..1550788 | - | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PALA22_RS07150 | 1550936..1551064 | + | 129 | Protein_1409 | integrase | - |
PALA22_RS07155 | 1551117..1551395 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA22_RS07160 (PALA22_01423) | 1551407..1551712 | + | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA22_RS07170 (PALA22_01425) | 1552118..1553218 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA22_RS07175 (PALA22_01426) | 1553259..1553843 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA22_RS07180 (PALA22_01427) | 1553885..1554499 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA22_RS07185 (PALA22_01428) | 1554616..1555557 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA22_RS07195 (PALA22_01430) | 1555724..1556572 | - | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T260595 WP_003113526.1 NZ_CP107275:1551117-1551395 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|