Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1413399..1414054 | Replicon | chromosome |
Accession | NZ_CP107268 | ||
Organism | Coxiella burnetii strain KZQ2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OHM79_RS07650 | Protein ID | WP_011996617.1 |
Coordinates | 1413716..1414054 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OHM79_RS07645 | Protein ID | WP_010958263.1 |
Coordinates | 1413399..1413710 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHM79_RS07625 | 1408691..1409368 | - | 678 | WP_011996613.1 | cyclin family protein | - |
OHM79_RS07630 | 1409671..1411053 | - | 1383 | WP_010958260.1 | cysteine--tRNA ligase | - |
OHM79_RS07635 | 1411044..1412441 | - | 1398 | WP_005772021.1 | glutamate--tRNA ligase | - |
OHM79_RS07640 | 1412598..1413329 | + | 732 | WP_005772022.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
OHM79_RS07645 | 1413399..1413710 | - | 312 | WP_010958263.1 | HigA family addiction module antitoxin | Antitoxin |
OHM79_RS07650 | 1413716..1414054 | - | 339 | WP_011996617.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OHM79_RS07655 | 1414413..1415558 | + | 1146 | WP_005771875.1 | ISAs1-like element ISCbu1 family transposase | - |
OHM79_RS07660 | 1415886..1417559 | + | 1674 | WP_238024397.1 | CBU_1493 family Dot/Icm T4SS effector | - |
OHM79_RS07665 | 1417733..1418488 | - | 756 | WP_010958266.1 | pyridoxine 5'-phosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1414413..1415558 | 1145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13428.63 Da Isoelectric Point: 10.2262
>T260586 WP_011996617.1 NZ_CP107268:c1414054-1413716 [Coxiella burnetii]
MPLTLYIMLDVTRKTVILEVMIKSFKDKYTKYLYEGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
MPLTLYIMLDVTRKTVILEVMIKSFKDKYTKYLYEGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|