Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2597400..2598046 | Replicon | chromosome |
Accession | NZ_CP107262 | ||
Organism | Leclercia adecarboxylata strain 2022CK-00320 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N5937_RS12990 | Protein ID | WP_103177685.1 |
Coordinates | 2597400..2597750 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N5937_RS12995 | Protein ID | WP_103177684.1 |
Coordinates | 2597747..2598046 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5937_RS12960 (2594105) | 2594105..2594275 | - | 171 | WP_164725120.1 | hypothetical protein | - |
N5937_RS12965 (2594554) | 2594554..2595312 | + | 759 | WP_263950098.1 | WYL domain-containing protein | - |
N5937_RS12970 (2595326) | 2595326..2595517 | - | 192 | WP_263950099.1 | toxin-antitoxin system HicB family antitoxin | - |
N5937_RS12975 (2595642) | 2595642..2595929 | + | 288 | WP_263950100.1 | SymE family type I addiction module toxin | - |
N5937_RS12980 (2596168) | 2596168..2596779 | + | 612 | WP_263950101.1 | hypothetical protein | - |
N5937_RS12985 (2596852) | 2596852..2597289 | - | 438 | WP_263950102.1 | acetyltransferase | - |
N5937_RS12990 (2597400) | 2597400..2597750 | + | 351 | WP_103177685.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5937_RS12995 (2597747) | 2597747..2598046 | + | 300 | WP_103177684.1 | XRE family transcriptional regulator | Antitoxin |
N5937_RS13000 (2598141) | 2598141..2598665 | - | 525 | WP_103177683.1 | lipocalin family protein | - |
N5937_RS13005 (2598783) | 2598783..2599511 | + | 729 | WP_263950103.1 | MerR family transcriptional regulator | - |
N5937_RS13010 (2599608) | 2599608..2600018 | + | 411 | WP_114385495.1 | hydroxyisourate hydrolase | - |
N5937_RS13015 (2600121) | 2600121..2601080 | + | 960 | WP_103177681.1 | DUF523 and DUF1722 domain-containing protein | - |
N5937_RS13020 (2601225) | 2601225..2602313 | + | 1089 | WP_159340366.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2594105..2605888 | 11783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13547.46 Da Isoelectric Point: 7.2761
>T260575 WP_103177685.1 NZ_CP107262:2597400-2597750 [Leclercia adecarboxylata]
MWTVILGEVFEAWLEDQEQGVQEKVFAALINLQTYGPRLPRPYADTVRGSRHNNMKELRIQYYGRPIRAFFAFDPVRQAI
VLCAGDKSHDKKFYERLIRIADDEFSAHLAAMETRN
MWTVILGEVFEAWLEDQEQGVQEKVFAALINLQTYGPRLPRPYADTVRGSRHNNMKELRIQYYGRPIRAFFAFDPVRQAI
VLCAGDKSHDKKFYERLIRIADDEFSAHLAAMETRN
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|