Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1320735..1321384 | Replicon | chromosome |
| Accession | NZ_CP107262 | ||
| Organism | Leclercia adecarboxylata strain 2022CK-00320 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N5937_RS06830 | Protein ID | WP_103178551.1 |
| Coordinates | 1320735..1321097 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5937_RS06835 | Protein ID | WP_103178550.1 |
| Coordinates | 1321085..1321384 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5937_RS06810 (1316018) | 1316018..1316992 | - | 975 | WP_103178554.1 | LacI family DNA-binding transcriptional regulator | - |
| N5937_RS06815 (1317068) | 1317068..1318210 | - | 1143 | WP_263951222.1 | Gfo/Idh/MocA family oxidoreductase | - |
| N5937_RS06820 (1318203) | 1318203..1319228 | - | 1026 | WP_263951223.1 | sugar phosphate isomerase/epimerase | - |
| N5937_RS06825 (1319243) | 1319243..1320481 | - | 1239 | WP_103181038.1 | MFS transporter | - |
| N5937_RS06830 (1320735) | 1320735..1321097 | + | 363 | WP_103178551.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5937_RS06835 (1321085) | 1321085..1321384 | + | 300 | WP_103178550.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N5937_RS06840 (1321429) | 1321429..1322817 | - | 1389 | WP_103178549.1 | phenylalanine transporter | - |
| N5937_RS06845 (1322921) | 1322921..1324894 | - | 1974 | WP_103178548.1 | PhoX family phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13964.90 Da Isoelectric Point: 7.3567
>T260569 WP_103178551.1 NZ_CP107262:1320735-1321097 [Leclercia adecarboxylata]
MWEVETTDMFDEWFHHQKQDLKEDVLAALHILSEYGPQLGRPWVDTVKASQYTNMKELRIQHAGDPIRAFFAFDPGRQAI
ILCAGNKTGAGDKRFYKRMINIADAEFSKYLASKEAKWQR
MWEVETTDMFDEWFHHQKQDLKEDVLAALHILSEYGPQLGRPWVDTVKASQYTNMKELRIQHAGDPIRAFFAFDPGRQAI
ILCAGNKTGAGDKRFYKRMINIADAEFSKYLASKEAKWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|