Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1990360..1990955 | Replicon | chromosome |
| Accession | NZ_CP107257 | ||
| Organism | Pseudomonas aeruginosa strain 2019CK-00034 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | N5938_RS09280 | Protein ID | WP_003113526.1 |
| Coordinates | 1990360..1990638 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | N5938_RS09285 | Protein ID | WP_003111575.1 |
| Coordinates | 1990650..1990955 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5938_RS09260 (N5938_09260) | 1985786..1987024 | + | 1239 | Protein_1821 | C69 family dipeptidase | - |
| N5938_RS09265 (N5938_09265) | 1987086..1987733 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| N5938_RS09270 (N5938_09270) | 1987803..1990031 | - | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| N5938_RS09275 (N5938_09275) | 1990179..1990307 | + | 129 | Protein_1824 | integrase | - |
| N5938_RS09280 (N5938_09280) | 1990360..1990638 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5938_RS09285 (N5938_09285) | 1990650..1990955 | + | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| N5938_RS09295 (N5938_09295) | 1991641..1992372 | + | 732 | WP_263901882.1 | STY4528 family pathogenicity island replication protein | - |
| N5938_RS09300 (N5938_09300) | 1992394..1992783 | + | 390 | WP_263901883.1 | hypothetical protein | - |
| N5938_RS09305 (N5938_09305) | 1993384..1994247 | + | 864 | WP_023098850.1 | integrase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T260563 WP_003113526.1 NZ_CP107257:1990360-1990638 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |