Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 1413433..1414088 | Replicon | chromosome |
| Accession | NZ_CP107247 | ||
| Organism | Coxiella burnetii strain KZQ3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OHM78_RS07665 | Protein ID | WP_011996617.1 |
| Coordinates | 1413750..1414088 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OHM78_RS07660 | Protein ID | WP_010958263.1 |
| Coordinates | 1413433..1413744 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHM78_RS07640 (OHM78_07640) | 1408725..1409402 | - | 678 | WP_011996613.1 | cyclin family protein | - |
| OHM78_RS07645 (OHM78_07645) | 1409705..1411087 | - | 1383 | WP_010958260.1 | cysteine--tRNA ligase | - |
| OHM78_RS07650 (OHM78_07650) | 1411078..1412475 | - | 1398 | WP_005772021.1 | glutamate--tRNA ligase | - |
| OHM78_RS07655 (OHM78_07655) | 1412632..1413363 | + | 732 | WP_005772022.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
| OHM78_RS07660 (OHM78_07660) | 1413433..1413744 | - | 312 | WP_010958263.1 | HigA family addiction module antitoxin | Antitoxin |
| OHM78_RS07665 (OHM78_07665) | 1413750..1414088 | - | 339 | WP_011996617.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OHM78_RS07670 (OHM78_07670) | 1414447..1415592 | + | 1146 | WP_005771875.1 | ISAs1-like element ISCbu1 family transposase | - |
| OHM78_RS07675 (OHM78_07675) | 1415920..1417593 | + | 1674 | WP_238024397.1 | CBU_1493 family Dot/Icm T4SS effector | - |
| OHM78_RS07680 (OHM78_07680) | 1417767..1418522 | - | 756 | WP_010958266.1 | pyridoxine 5'-phosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1414447..1415592 | 1145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13428.63 Da Isoelectric Point: 10.2262
>T260560 WP_011996617.1 NZ_CP107247:c1414088-1413750 [Coxiella burnetii]
MPLTLYIMLDVTRKTVILEVMIKSFKDKYTKYLYEGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
MPLTLYIMLDVTRKTVILEVMIKSFKDKYTKYLYEGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|