Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 3142385..3142972 | Replicon | chromosome |
Accession | NZ_CP107241 | ||
Organism | Xanthomonas hortorum strain Oregano 108 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OEG85_RS13470 | Protein ID | WP_268211660.1 |
Coordinates | 3142694..3142972 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OEG85_RS13465 | Protein ID | WP_268211659.1 |
Coordinates | 3142385..3142684 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG85_RS13440 (OEG85_13435) | 3137889..3138773 | + | 885 | WP_006451802.1 | MinD/ParA family protein | - |
OEG85_RS13445 (OEG85_13440) | 3138770..3139543 | + | 774 | WP_023903918.1 | RNA polymerase sigma factor FliA | - |
OEG85_RS13450 (OEG85_13445) | 3139579..3139971 | + | 393 | WP_002813536.1 | chemotaxis response regulator CheY | - |
OEG85_RS13455 (OEG85_13450) | 3139971..3140597 | + | 627 | WP_006450905.1 | protein phosphatase CheZ | - |
OEG85_RS13460 (OEG85_13455) | 3140600..3142258 | + | 1659 | WP_268211658.1 | chemotaxis protein CheA | - |
OEG85_RS13465 (OEG85_13460) | 3142385..3142684 | - | 300 | WP_268211659.1 | HigA family addiction module antitoxin | Antitoxin |
OEG85_RS13470 (OEG85_13465) | 3142694..3142972 | - | 279 | WP_268211660.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEG85_RS13475 (OEG85_13470) | 3143599..3144339 | + | 741 | WP_006452732.1 | flagellar motor protein | - |
OEG85_RS13480 (OEG85_13475) | 3144347..3145321 | + | 975 | WP_268211661.1 | flagellar motor protein MotD | - |
OEG85_RS13485 (OEG85_13480) | 3145323..3146105 | + | 783 | WP_006452730.1 | ParA family protein | - |
OEG85_RS13490 (OEG85_13485) | 3146102..3147352 | + | 1251 | WP_268211662.1 | chemotaxis protein CheW | - |
OEG85_RS13495 (OEG85_13490) | 3147456..3147764 | + | 309 | WP_006448510.1 | STAS domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10593.05 Da Isoelectric Point: 8.5635
>T260549 WP_268211660.1 NZ_CP107241:c3142972-3142694 [Xanthomonas hortorum]
MIQSFRCKHTRALFEGASPRQFRSMQAAAERKLQLLDSAQTLEFLRSPPGNRLELLAGTRAGQHSIRINDQWRVCFVWTD
AGPEHVEIVDYH
MIQSFRCKHTRALFEGASPRQFRSMQAAAERKLQLLDSAQTLEFLRSPPGNRLELLAGTRAGQHSIRINDQWRVCFVWTD
AGPEHVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|